CD3G monoclonal antibody (M01), clone 2A6
  • CD3G monoclonal antibody (M01), clone 2A6

CD3G monoclonal antibody (M01), clone 2A6

Ref: AB-H00000917-M01
CD3G monoclonal antibody (M01), clone 2A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD3G.
Información adicional
Size 100 ug
Gene Name CD3G
Gene Alias CD3-GAMMA|FLJ17620|FLJ17664|FLJ79544|FLJ94613|MGC138597|T3G
Gene Description CD3g molecule, gamma (CD3-TCR complex)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 917
Clone Number 2A6
Iso type IgG2a Kappa

Enviar un mensaje


CD3G monoclonal antibody (M01), clone 2A6

CD3G monoclonal antibody (M01), clone 2A6