CD3E monoclonal antibody (M01), clone 3H5
  • CD3E monoclonal antibody (M01), clone 3H5

CD3E monoclonal antibody (M01), clone 3H5

Ref: AB-H00000916-M01
CD3E monoclonal antibody (M01), clone 3H5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CD3E.
Información adicional
Size 100 ug
Gene Name CD3E
Gene Alias FLJ18683|T3E|TCRE
Gene Description CD3e molecule, epsilon (CD3-TCR complex)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD3E (AAH49847.1, 23 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 916
Clone Number 3H5
Iso type IgG2b Kappa

Enviar un mensaje


CD3E monoclonal antibody (M01), clone 3H5

CD3E monoclonal antibody (M01), clone 3H5