CD1B purified MaxPab rabbit polyclonal antibody (D01P)
  • CD1B purified MaxPab rabbit polyclonal antibody (D01P)

CD1B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000910-D01P
CD1B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD1B protein.
Información adicional
Size 100 ug
Gene Name CD1B
Gene Alias CD1|CD1A|MGC125990|MGC125991|R1
Gene Description CD1b molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD1B (NP_001755.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 910

Enviar un mensaje


CD1B purified MaxPab rabbit polyclonal antibody (D01P)

CD1B purified MaxPab rabbit polyclonal antibody (D01P)