CCNT2 monoclonal antibody (M03), clone 1H3
  • CCNT2 monoclonal antibody (M03), clone 1H3

CCNT2 monoclonal antibody (M03), clone 1H3

Ref: AB-H00000905-M03
CCNT2 monoclonal antibody (M03), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCNT2.
Información adicional
Size 100 ug
Gene Name CCNT2
Gene Alias FLJ90560|MGC134840
Gene Description cyclin T2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNT2 (NP_490595, 264 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 905
Clone Number 1H3
Iso type IgG2a Kappa

Enviar un mensaje


CCNT2 monoclonal antibody (M03), clone 1H3

CCNT2 monoclonal antibody (M03), clone 1H3