CCK monoclonal antibody (M02), clone 2A5
  • CCK monoclonal antibody (M02), clone 2A5

CCK monoclonal antibody (M02), clone 2A5

Ref: AB-H00000885-M02
CCK monoclonal antibody (M02), clone 2A5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CCK.
Información adicional
Size 100 ug
Gene Name CCK
Gene Alias MGC117187
Gene Description cholecystokinin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCK (AAH08283, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 885
Clone Number 2A5
Iso type IgG2a Kappa

Enviar un mensaje


CCK monoclonal antibody (M02), clone 2A5

CCK monoclonal antibody (M02), clone 2A5