CBS monoclonal antibody (M01), clone 3E1
  • CBS monoclonal antibody (M01), clone 3E1

CBS monoclonal antibody (M01), clone 3E1

Ref: AB-H00000875-M01
CBS monoclonal antibody (M01), clone 3E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CBS.
Información adicional
Size 50 ug
Gene Name CBS
Gene Alias HIP4
Gene Description cystathionine-beta-synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 875
Clone Number 3E1
Iso type IgG2a Kappa

Enviar un mensaje


CBS monoclonal antibody (M01), clone 3E1

CBS monoclonal antibody (M01), clone 3E1