CBS purified MaxPab rabbit polyclonal antibody (D01P)
  • CBS purified MaxPab rabbit polyclonal antibody (D01P)

CBS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000875-D01P
CBS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CBS protein.
Información adicional
Size 100 ug
Gene Name CBS
Gene Alias HIP4
Gene Description cystathionine-beta-synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CBS (NP_000062.1, 1 a.a. ~ 551 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 875

Enviar un mensaje


CBS purified MaxPab rabbit polyclonal antibody (D01P)

CBS purified MaxPab rabbit polyclonal antibody (D01P)