CBS polyclonal antibody (A01)
  • CBS polyclonal antibody (A01)

CBS polyclonal antibody (A01)

Ref: AB-H00000875-A01
CBS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CBS.
Información adicional
Size 50 uL
Gene Name CBS
Gene Alias HIP4
Gene Description cystathionine-beta-synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CBS (AAH11381.1, 1 a.a. ~ 551 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 875

Enviar un mensaje


CBS polyclonal antibody (A01)

CBS polyclonal antibody (A01)