RUNX3 purified MaxPab mouse polyclonal antibody (B01P)
  • RUNX3 purified MaxPab mouse polyclonal antibody (B01P)

RUNX3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000864-B01P
RUNX3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RUNX3 protein.
Información adicional
Size 50 ug
Gene Name RUNX3
Gene Alias AML2|CBFA3|FLJ34510|MGC16070|PEBP2aC
Gene Description runt-related transcription factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RUNX3 (AAH13362.1, 1 a.a. ~ 429 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 864

Enviar un mensaje


RUNX3 purified MaxPab mouse polyclonal antibody (B01P)

RUNX3 purified MaxPab mouse polyclonal antibody (B01P)