RUNX3 polyclonal antibody (A01)
  • RUNX3 polyclonal antibody (A01)

RUNX3 polyclonal antibody (A01)

Ref: AB-H00000864-A01
RUNX3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RUNX3.
Información adicional
Size 50 uL
Gene Name RUNX3
Gene Alias AML2|CBFA3|FLJ34510|MGC16070|PEBP2aC
Gene Description runt-related transcription factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RUNX3 (NP_004341, 194 a.a. ~ 279 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 864

Enviar un mensaje


RUNX3 polyclonal antibody (A01)

RUNX3 polyclonal antibody (A01)