CAV1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CAV1 purified MaxPab rabbit polyclonal antibody (D01P)

CAV1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000857-D01P
CAV1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAV1 protein.
Información adicional
Size 100 ug
Gene Name CAV1
Gene Alias BSCL3|CAV|CGL3|MSTP085|VIP21
Gene Description caveolin 1, caveolae protein, 22kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAV1 (AAH82246.1, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 857

Enviar un mensaje


CAV1 purified MaxPab rabbit polyclonal antibody (D01P)

CAV1 purified MaxPab rabbit polyclonal antibody (D01P)