CAT purified MaxPab rabbit polyclonal antibody (D01P)
  • CAT purified MaxPab rabbit polyclonal antibody (D01P)

CAT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000847-D01P
CAT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAT protein.
Información adicional
Size 100 ug
Gene Name CAT
Gene Alias MGC138422|MGC138424
Gene Description catalase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAT (NP_001743.1, 1 a.a. ~ 527 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 847

Enviar un mensaje


CAT purified MaxPab rabbit polyclonal antibody (D01P)

CAT purified MaxPab rabbit polyclonal antibody (D01P)