Ver mas grande
CASQ2 monoclonal antibody (M07), clone 1C6
AB-H00000845-M07
Producto nuevo
CASQ2 monoclonal antibody (M07), clone 1C6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CASQ2 |
| Gene Alias | FLJ26321|FLJ93514|PDIB2 |
| Gene Description | calsequestrin 2 (cardiac muscle) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,IHC-P,ELISA |
| Immunogen Prot. Seq | EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CASQ2 (AAH22288, 20 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 845 |
| Clone Number | 1C6 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant CASQ2.