CASQ2 monoclonal antibody (M07), clone 1C6
  • CASQ2 monoclonal antibody (M07), clone 1C6

CASQ2 monoclonal antibody (M07), clone 1C6

Ref: AB-H00000845-M07
CASQ2 monoclonal antibody (M07), clone 1C6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CASQ2.
Información adicional
Size 100 ug
Gene Name CASQ2
Gene Alias FLJ26321|FLJ93514|PDIB2
Gene Description calsequestrin 2 (cardiac muscle)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASQ2 (AAH22288, 20 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 845
Clone Number 1C6
Iso type IgG2b Kappa

Enviar un mensaje


CASQ2 monoclonal antibody (M07), clone 1C6

CASQ2 monoclonal antibody (M07), clone 1C6