CASP10 monoclonal antibody (M02), clone 2E7
  • CASP10 monoclonal antibody (M02), clone 2E7

CASP10 monoclonal antibody (M02), clone 2E7

Ref: AB-H00000843-M02
CASP10 monoclonal antibody (M02), clone 2E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CASP10.
Información adicional
Size 100 ug
Gene Name CASP10
Gene Alias ALPS2|FLICE2|MCH4
Gene Description caspase 10, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASP10 (NP_116756, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 843
Clone Number 2E7
Iso type IgG2a Kappa

Enviar un mensaje


CASP10 monoclonal antibody (M02), clone 2E7

CASP10 monoclonal antibody (M02), clone 2E7