CASP3 monoclonal antibody (M02), clone 4D3
  • CASP3 monoclonal antibody (M02), clone 4D3

CASP3 monoclonal antibody (M02), clone 4D3

Ref: AB-H00000836-M02
CASP3 monoclonal antibody (M02), clone 4D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CASP3.
Información adicional
Size 100 ug
Gene Name CASP3
Gene Alias CPP32|CPP32B|SCA-1
Gene Description caspase 3, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASP3 (AAH16926.1, 176 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 836
Clone Number 4D3
Iso type IgG2a Kappa

Enviar un mensaje


CASP3 monoclonal antibody (M02), clone 4D3

CASP3 monoclonal antibody (M02), clone 4D3