CASP2 monoclonal antibody (M10), clone 1C11
  • CASP2 monoclonal antibody (M10), clone 1C11

CASP2 monoclonal antibody (M10), clone 1C11

Ref: AB-H00000835-M10
CASP2 monoclonal antibody (M10), clone 1C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CASP2.
Información adicional
Size 100 ug
Gene Name CASP2
Gene Alias CASP-2|ICH-1L|ICH-1L/1S|ICH1|NEDD2
Gene Description caspase 2, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASP2 (AAH02427, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 835
Clone Number 1C11
Iso type IgG2a Kappa

Enviar un mensaje


CASP2 monoclonal antibody (M10), clone 1C11

CASP2 monoclonal antibody (M10), clone 1C11