CASP2 polyclonal antibody (A01)
  • CASP2 polyclonal antibody (A01)

CASP2 polyclonal antibody (A01)

Ref: AB-H00000835-A01
CASP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CASP2.
Información adicional
Size 50 uL
Gene Name CASP2
Gene Alias CASP-2|ICH-1L|ICH-1L/1S|ICH1|NEDD2
Gene Description caspase 2, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASP2 (AAH02427, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 835

Enviar un mensaje


CASP2 polyclonal antibody (A01)

CASP2 polyclonal antibody (A01)