CAPZB MaxPab mouse polyclonal antibody (B01P)
  • CAPZB MaxPab mouse polyclonal antibody (B01P)

CAPZB MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000832-B01P
CAPZB MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CAPZB protein.
Información adicional
Size 50 ug
Gene Name CAPZB
Gene Alias CAPB|CAPPB|CAPZ|MGC104401|MGC129749|MGC129750
Gene Description capping protein (actin filament) muscle Z-line, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLNLCFMLTRHAVHSLDSFLRKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFCHTSLSVLSTFP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAPZB (AAH08095.1, 1 a.a. ~ 79 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 832

Enviar un mensaje


CAPZB MaxPab mouse polyclonal antibody (B01P)

CAPZB MaxPab mouse polyclonal antibody (B01P)