CAST purified MaxPab rabbit polyclonal antibody (D01P)
  • CAST purified MaxPab rabbit polyclonal antibody (D01P)

CAST purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000831-D01P
CAST purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAST protein.
Información adicional
Size 100 ug
Gene Name CAST
Gene Alias BS-17|MGC9402
Gene Description calpastatin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNPTETKAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAST (NP_775083.1, 1 a.a. ~ 686 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 831

Enviar un mensaje


CAST purified MaxPab rabbit polyclonal antibody (D01P)

CAST purified MaxPab rabbit polyclonal antibody (D01P)