CAMLG polyclonal antibody (A01)
  • CAMLG polyclonal antibody (A01)

CAMLG polyclonal antibody (A01)

Ref: AB-H00000819-A01
CAMLG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CAMLG.
Información adicional
Size 50 uL
Gene Name CAMLG
Gene Alias CAML|MGC163197
Gene Description calcium modulating ligand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAMLG (NP_001736, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 819

Enviar un mensaje


CAMLG polyclonal antibody (A01)

CAMLG polyclonal antibody (A01)