CAMK2A monoclonal antibody (M02), clone 1H7
  • CAMK2A monoclonal antibody (M02), clone 1H7

CAMK2A monoclonal antibody (M02), clone 1H7

Ref: AB-H00000815-M02
CAMK2A monoclonal antibody (M02), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAMK2A.
Información adicional
Size 100 ug
Gene Name CAMK2A
Gene Alias CAMKA|KIAA0968
Gene Description calcium/calmodulin-dependent protein kinase II alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAMK2A (AAH40457, 305 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 815
Clone Number 1H7
Iso type IgG2a Kappa

Enviar un mensaje


CAMK2A monoclonal antibody (M02), clone 1H7

CAMK2A monoclonal antibody (M02), clone 1H7