CALCR monoclonal antibody (M01), clone 2F7
  • CALCR monoclonal antibody (M01), clone 2F7

CALCR monoclonal antibody (M01), clone 2F7

Ref: AB-H00000799-M01
CALCR monoclonal antibody (M01), clone 2F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CALCR.
Información adicional
Size 100 ug
Gene Name CALCR
Gene Alias CRT|CTR|CTR1
Gene Description calcitonin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CALCR (NP_001733.1, 394 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 799
Clone Number 2F7
Iso type IgG2a Kappa

Enviar un mensaje


CALCR monoclonal antibody (M01), clone 2F7

CALCR monoclonal antibody (M01), clone 2F7