CALCR purified MaxPab rabbit polyclonal antibody (D01P)
  • CALCR purified MaxPab rabbit polyclonal antibody (D01P)

CALCR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000799-D01P
CALCR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CALCR protein.
Información adicional
Size 100 ug
Gene Name CALCR
Gene Alias CRT|CTR|CTR1
Gene Description calcitonin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVAVFTE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALCR (NP_001733.1, 1 a.a. ~ 474 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 799

Enviar un mensaje


CALCR purified MaxPab rabbit polyclonal antibody (D01P)

CALCR purified MaxPab rabbit polyclonal antibody (D01P)