CACNA1C polyclonal antibody (A01)
  • CACNA1C polyclonal antibody (A01)

CACNA1C polyclonal antibody (A01)

Ref: AB-H00000775-A01
CACNA1C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CACNA1C.
Información adicional
Size 50 uL
Gene Name CACNA1C
Gene Alias CACH2|CACN2|CACNL1A1|CCHL1A1|CaV1.2|MGC120730|TS
Gene Description calcium channel, voltage-dependent, L type, alpha 1C subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CACNA1C (NP_000710, 2039 a.a. ~ 2138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 775

Enviar un mensaje


CACNA1C polyclonal antibody (A01)

CACNA1C polyclonal antibody (A01)