CA8 polyclonal antibody (A01)
  • CA8 polyclonal antibody (A01)

CA8 polyclonal antibody (A01)

Ref: AB-H00000767-A01
CA8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CA8.
Información adicional
Size 50 uL
Gene Name CA8
Gene Alias CA-VIII|CALS|CARP|MGC120502|MGC99509
Gene Description carbonic anhydrase VIII
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CA8 (NP_004047, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 767

Enviar un mensaje


CA8 polyclonal antibody (A01)

CA8 polyclonal antibody (A01)