CA3 purified MaxPab mouse polyclonal antibody (B01P)
  • CA3 purified MaxPab mouse polyclonal antibody (B01P)

CA3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000761-B01P
CA3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CA3 protein.
Información adicional
Size 50 ug
Gene Name CA3
Gene Alias CAIII|Car3
Gene Description carbonic anhydrase III, muscle specific
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CA3 (NP_005172.1, 1 a.a. ~ 260 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 761

Enviar un mensaje


CA3 purified MaxPab mouse polyclonal antibody (B01P)

CA3 purified MaxPab mouse polyclonal antibody (B01P)