CA1 polyclonal antibody (A01)
  • CA1 polyclonal antibody (A01)

CA1 polyclonal antibody (A01)

Ref: AB-H00000759-A01
CA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CA1.
Información adicional
Size 50 uL
Gene Name CA1
Gene Alias Car1
Gene Description carbonic anhydrase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 759

Enviar un mensaje


CA1 polyclonal antibody (A01)

CA1 polyclonal antibody (A01)