C21orf2 purified MaxPab mouse polyclonal antibody (B01P)
  • C21orf2 purified MaxPab mouse polyclonal antibody (B01P)

C21orf2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000755-B01P
C21orf2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C21orf2 protein.
Información adicional
Size 50 ug
Gene Name C21orf2
Gene Alias A2|YF5
Gene Description chromosome 21 open reading frame 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNSISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAAPEREGTGHGGPKLCCTLSSLSSAAETGRDPLDSEEEATGAQDERGLKPPSRGQFPSLSARDASSSHRGRVSGGPLGAAAASAHCTHCTETVGREHGASQGPVGREHGASQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C21orf2 (AAH31300.1, 1 a.a. ~ 375 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 755

Enviar un mensaje


C21orf2 purified MaxPab mouse polyclonal antibody (B01P)

C21orf2 purified MaxPab mouse polyclonal antibody (B01P)