ZNHIT2 monoclonal antibody (M05), clone 4G11
  • ZNHIT2 monoclonal antibody (M05), clone 4G11

ZNHIT2 monoclonal antibody (M05), clone 4G11

Ref: AB-H00000741-M05
ZNHIT2 monoclonal antibody (M05), clone 4G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNHIT2.
Información adicional
Size 100 ug
Gene Name ZNHIT2
Gene Alias C11orf5|FON|MGC120285|MGC120286
Gene Description zinc finger, HIT type 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEAALTPLALDC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNHIT2 (NP_055020.1, 274 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 741
Clone Number 4G11
Iso type IgG2a Kappa

Enviar un mensaje


ZNHIT2 monoclonal antibody (M05), clone 4G11

ZNHIT2 monoclonal antibody (M05), clone 4G11