OSGIN2 monoclonal antibody (M15), clone 2C4
  • OSGIN2 monoclonal antibody (M15), clone 2C4

OSGIN2 monoclonal antibody (M15), clone 2C4

Ref: AB-H00000734-M15
OSGIN2 monoclonal antibody (M15), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OSGIN2.
Información adicional
Size 100 ug
Gene Name OSGIN2
Gene Alias C8orf1|hT41
Gene Description oxidative stress induced growth inhibitor family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGGDGIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OSGIN2 (AAH31054, 398 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 734
Clone Number 2C4
Iso type IgG2b Kappa

Enviar un mensaje


OSGIN2 monoclonal antibody (M15), clone 2C4

OSGIN2 monoclonal antibody (M15), clone 2C4