C4BPA purified MaxPab rabbit polyclonal antibody (D01P)
  • C4BPA purified MaxPab rabbit polyclonal antibody (D01P)

C4BPA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000722-D01P
C4BPA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C4BPA protein.
Información adicional
Size 100 ug
Gene Name C4BPA
Gene Alias C4BP|PRP
Gene Description complement component 4 binding protein, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C4BPA (NP_000706.1, 1 a.a. ~ 597 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 722

Enviar un mensaje


C4BPA purified MaxPab rabbit polyclonal antibody (D01P)

C4BPA purified MaxPab rabbit polyclonal antibody (D01P)