C3 monoclonal antibody (M10), clone 1D20
  • C3 monoclonal antibody (M10), clone 1D20

C3 monoclonal antibody (M10), clone 1D20

Ref: AB-H00000718-M10
C3 monoclonal antibody (M10), clone 1D20

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C3.
Información adicional
Size 100 ug
Gene Name C3
Gene Alias ARMD9|ASP|CPAMD1
Gene Description complement component 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 718
Clone Number 1D20
Iso type IgG2b Kappa

Enviar un mensaje


C3 monoclonal antibody (M10), clone 1D20

C3 monoclonal antibody (M10), clone 1D20