Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
C3 monoclonal antibody (M10), clone 1D20
Abnova
C3 monoclonal antibody (M10), clone 1D20
Ref: AB-H00000718-M10
C3 monoclonal antibody (M10), clone 1D20
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant C3.
Información adicional
Size
100 ug
Gene Name
C3
Gene Alias
ARMD9|ASP|CPAMD1
Gene Description
complement component 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA
Immunogen Prot. Seq
DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
718
Clone Number
1D20
Iso type
IgG2b Kappa
Enviar un mensaje
C3 monoclonal antibody (M10), clone 1D20
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*