C3 polyclonal antibody (A01)
  • C3 polyclonal antibody (A01)

C3 polyclonal antibody (A01)

Ref: AB-H00000718-A01
C3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C3.
Información adicional
Size 50 uL
Gene Name C3
Gene Alias ARMD9|ASP|CPAMD1
Gene Description complement component 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 718

Enviar un mensaje


C3 polyclonal antibody (A01)

C3 polyclonal antibody (A01)