C2 purified MaxPab rabbit polyclonal antibody (D01P)
  • C2 purified MaxPab rabbit polyclonal antibody (D01P)

C2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000717-D01P
C2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C2 protein.
Información adicional
Size 100 ug
Gene Name C2
Gene Alias CO2|DKFZp779M0311
Gene Description complement component 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRSGHLNL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C2 (NP_000054.2, 1 a.a. ~ 752 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 717

Enviar un mensaje


C2 purified MaxPab rabbit polyclonal antibody (D01P)

C2 purified MaxPab rabbit polyclonal antibody (D01P)