C1QB purified MaxPab mouse polyclonal antibody (B01P)
  • C1QB purified MaxPab mouse polyclonal antibody (B01P)

C1QB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000713-B01P
C1QB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1QB protein.
Información adicional
Size 50 ug
Gene Name C1QB
Gene Alias -
Gene Description complement component 1, q subcomponent, B chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1QB (AAH08983, 1 a.a. ~ 253 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 713

Enviar un mensaje


C1QB purified MaxPab mouse polyclonal antibody (B01P)

C1QB purified MaxPab mouse polyclonal antibody (B01P)