Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
C1QB purified MaxPab mouse polyclonal antibody (B01P)
Abnova
C1QB purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00000713-B01P
C1QB purified MaxPab mouse polyclonal antibody (B01P)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human C1QB protein.
Información adicional
Size
50 ug
Gene Name
C1QB
Gene Alias
-
Gene Description
complement component 1, q subcomponent, B chain
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Tr
Immunogen Prot. Seq
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
C1QB (AAH08983, 1 a.a. ~ 253 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
713
Enviar un mensaje
C1QB purified MaxPab mouse polyclonal antibody (B01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*