C1QA purified MaxPab mouse polyclonal antibody (B01P)
  • C1QA purified MaxPab mouse polyclonal antibody (B01P)

C1QA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000712-B01P
C1QA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1QA protein.
Información adicional
Size 50 ug
Gene Name C1QA
Gene Alias -
Gene Description complement component 1, q subcomponent, A chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1QA (AAH30153, 23 a.a. ~ 245 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 712

Enviar un mensaje


C1QA purified MaxPab mouse polyclonal antibody (B01P)

C1QA purified MaxPab mouse polyclonal antibody (B01P)