BZRP polyclonal antibody (A01)
  • BZRP polyclonal antibody (A01)

BZRP polyclonal antibody (A01)

Ref: AB-H00000706-A01
BZRP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant BZRP.
Información adicional
Size 50 uL
Gene Name TSPO
Gene Alias BZRP|DBI|IBP|MBR|PBR|PKBS|PTBR|mDRC|pk18
Gene Description translocator protein (18kDa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BZRP (AAH01110.1, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 706

Enviar un mensaje


BZRP polyclonal antibody (A01)

BZRP polyclonal antibody (A01)