BTC MaxPab rabbit polyclonal antibody (D01)
  • BTC MaxPab rabbit polyclonal antibody (D01)

BTC MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000685-D01
BTC MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BTC protein.
Información adicional
Size 100 uL
Gene Name BTC
Gene Alias -
Gene Description betacellulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTC (NP_001720.1, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 685

Enviar un mensaje


BTC MaxPab rabbit polyclonal antibody (D01)

BTC MaxPab rabbit polyclonal antibody (D01)