BRCA1 polyclonal antibody (A01)
  • BRCA1 polyclonal antibody (A01)

BRCA1 polyclonal antibody (A01)

Ref: AB-H00000672-A01
BRCA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BRCA1.
Información adicional
Size 50 uL
Gene Name BRCA1
Gene Alias BRCAI|BRCC1|IRIS|PSCP|RNF53
Gene Description breast cancer 1, early onset
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EDRAPESARVGNIPSSTSALKVPQLKVAESAQGPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BRCA1 (NP_009225, 1581 a.a. ~ 1670 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 672

Enviar un mensaje


BRCA1 polyclonal antibody (A01)

BRCA1 polyclonal antibody (A01)