Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
BMP7 monoclonal antibody (M03), clone S52
Abnova
BMP7 monoclonal antibody (M03), clone S52
Ref: AB-H00000655-M03
BMP7 monoclonal antibody (M03), clone S52
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant BMP7.
Información adicional
Size
100 ug
Gene Name
BMP7
Gene Alias
OP-1
Gene Description
bone morphogenetic protein 7
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BMP7 (AAH08584, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
655
Clone Number
S52
Iso type
IgG1 Kappa
Enviar un mensaje
BMP7 monoclonal antibody (M03), clone S52
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*