BMP1 purified MaxPab mouse polyclonal antibody (B01P)
  • BMP1 purified MaxPab mouse polyclonal antibody (B01P)

BMP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000649-B01P
BMP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BMP1 protein.
Información adicional
Size 50 ug
Gene Name BMP1
Gene Alias FLJ44432|PCOLC|PCP|TLD|pCP-2
Gene Description bone morphogenetic protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BMP1 (ENSP00000307408, 1 a.a. ~ 622 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 649

Enviar un mensaje


BMP1 purified MaxPab mouse polyclonal antibody (B01P)

BMP1 purified MaxPab mouse polyclonal antibody (B01P)