BLVRB polyclonal antibody (A01)
  • BLVRB polyclonal antibody (A01)

BLVRB polyclonal antibody (A01)

Ref: AB-H00000645-A01
BLVRB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BLVRB.
Información adicional
Size 50 uL
Gene Name BLVRB
Gene Alias BVRB|FLR|MGC117413|SDR43U1
Gene Description biliverdin reductase B (flavin reductase (NADPH))
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BLVRB (NP_000704, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 645

Enviar un mensaje


BLVRB polyclonal antibody (A01)

BLVRB polyclonal antibody (A01)