BLVRA monoclonal antibody (M01A), clone S1
  • BLVRA monoclonal antibody (M01A), clone S1

BLVRA monoclonal antibody (M01A), clone S1

Ref: AB-H00000644-M01A
BLVRA monoclonal antibody (M01A), clone S1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant BLVRA.
Información adicional
Size 200 uL
Gene Name BLVRA
Gene Alias BLVR|BVR|BVRA
Gene Description biliverdin reductase A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BLVRA (AAH08456, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 644
Clone Number S1
Iso type IgG2a Kappa

Enviar un mensaje


BLVRA monoclonal antibody (M01A), clone S1

BLVRA monoclonal antibody (M01A), clone S1