BLMH polyclonal antibody (A01)
  • BLMH polyclonal antibody (A01)

BLMH polyclonal antibody (A01)

Ref: AB-H00000642-A01
BLMH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BLMH.
Información adicional
Size 50 uL
Gene Name BLMH
Gene Alias BH|BMH
Gene Description bleomycin hydrolase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BLMH (NP_000377, 356 a.a. ~ 454 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 642

Enviar un mensaje


BLMH polyclonal antibody (A01)

BLMH polyclonal antibody (A01)