BLK monoclonal antibody (M02), clone 7A12
  • BLK monoclonal antibody (M02), clone 7A12

BLK monoclonal antibody (M02), clone 7A12

Ref: AB-H00000640-M02
BLK monoclonal antibody (M02), clone 7A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BLK.
Información adicional
Size 100 ug
Gene Name BLK
Gene Alias MGC10442
Gene Description B lymphoid tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BLK (AAH07371, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 640
Clone Number 7A12
Iso type IgG1 Kappa

Enviar un mensaje


BLK monoclonal antibody (M02), clone 7A12

BLK monoclonal antibody (M02), clone 7A12