Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
PRDM1 monoclonal antibody (M10), clone 1G9
Abnova
PRDM1 monoclonal antibody (M10), clone 1G9
Ref: AB-H00000639-M10
PRDM1 monoclonal antibody (M10), clone 1G9
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant PRDM1.
Información adicional
Size
100 ug
Gene Name
PRDM1
Gene Alias
BLIMP1|MGC118922|MGC118923|MGC118924|MGC118925|PRDI-BF1
Gene Description
PR domain containing 1, with ZNF domain
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Re,ELISA,IF
Immunogen Prot. Seq
HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
PRDM1 (NP_001189, 422 a.a. ~ 493 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
639
Clone Number
1G9
Iso type
IgG2a Kappa
Enviar un mensaje
PRDM1 monoclonal antibody (M10), clone 1G9
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*