PRDM1 monoclonal antibody (M03), clone 1G6
  • PRDM1 monoclonal antibody (M03), clone 1G6

PRDM1 monoclonal antibody (M03), clone 1G6

Ref: AB-H00000639-M03
PRDM1 monoclonal antibody (M03), clone 1G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRDM1.
Información adicional
Size 100 ug
Gene Name PRDM1
Gene Alias BLIMP1|MGC118922|MGC118923|MGC118924|MGC118925|PRDI-BF1
Gene Description PR domain containing 1, with ZNF domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,S-ELISA,ELISA
Immunogen Prot. Seq MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDM1 (NP_001189, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 639
Clone Number 1G6
Iso type IgG2a Kappa

Enviar un mensaje


PRDM1 monoclonal antibody (M03), clone 1G6

PRDM1 monoclonal antibody (M03), clone 1G6