Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
PRDM1 MaxPab mouse polyclonal antibody (B01)
Abnova
PRDM1 MaxPab mouse polyclonal antibody (B01)
Ref: AB-H00000639-B01
PRDM1 MaxPab mouse polyclonal antibody (B01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human PRDM1 protein.
Información adicional
Size
50 uL
Gene Name
PRDM1
Gene Alias
BLIMP1|MGC118922|MGC118923|MGC118924|MGC118925|PRDI-BF1
Gene Description
PR domain containing 1, with ZNF domain
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRRGSPEM
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
PRDM1 (NP_001189.1, 1 a.a. ~ 789 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
639
Enviar un mensaje
PRDM1 MaxPab mouse polyclonal antibody (B01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*