AB-H00000634-M02
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | CEACAM1 |
Gene Alias | BGP|BGP1|BGPI |
Gene Description | carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | S-ELISA,ELISA |
Immunogen Prot. Seq | VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | CEACAM1 (AAH14473, 305 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 634 |
Clone Number | 2F9 |
Iso type | IgG1 Kappa |