BGN purified MaxPab rabbit polyclonal antibody (D01P)
  • BGN purified MaxPab rabbit polyclonal antibody (D01P)

BGN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000633-D01P
BGN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BGN protein.
Información adicional
Size 100 ug
Gene Name BGN
Gene Alias DSPG1|PG-S1|PGI|SLRR1A
Gene Description biglycan
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BGN (NP_001702.1, 1 a.a. ~ 368 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 633

Enviar un mensaje


BGN purified MaxPab rabbit polyclonal antibody (D01P)

BGN purified MaxPab rabbit polyclonal antibody (D01P)